PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA93G00267
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 685aa    MW: 74902.4 Da    PI: 6.1336
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA93G00267genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.31.8e-14207268162
                 XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                 e+ +k+  r+++NRe+A+ sR+RKk+++eeL+ kvk++ +  ++L  +++    e a+lk++
  AA93G00267 207 EEYDKKKVRLIRNRESAQLSRLRKKQYVEELQGKVKSMHSTITELTGKISYFMAENAALKQQ 268
                 5679*******************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.7E-16207271IPR004827Basic-leucine zipper domain
PfamPF001701.1E-11208269IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.473209272IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.81E-12211269No hitNo description
Gene3DG3DSA:1.20.5.1701.6E-15211270No hitNo description
CDDcd147048.33E-18212263No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006990Biological Processpositive regulation of transcription from RNA polymerase II promoter involved in unfolded protein response
GO:0009408Biological Processresponse to heat
GO:0005635Cellular Componentnuclear envelope
GO:0005654Cellular Componentnucleoplasm
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016020Cellular Componentmembrane
GO:0048471Cellular Componentperinuclear region of cytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 685 aa     Download sequence    Send to blast
MTESTSVIAL PPLMADENTN ISSESEILSI PPLDPLFLST SDPISMDFSE IDLFGDDDNF  60
DFSDLDLSFT NSDDFFNFHV DMEPTAIAEI PPDSVTDLRS SEDRGSEVTG NQINVEASGT  120
RNGEGGSSEE ASDSVNSQVS SHGSMTSVPA VCDTVDALSP DSKNLGFQKK PGSNSVSKRK  180
KEKGDVGDEY RSSKYSKADE KSAVTSEEYD KKKVRLIRNR ESAQLSRLRK KQYVEELQGK  240
VKSMHSTITE LTGKISYFMA ENAALKQQMA AASGAPMNPY MAGPPLPYQW MQYPYPVRAS  300
QIPVLPIPKL KTQPISSCRP KKPEIKKNPI KSKLKKVASI SFIGIVFLLF VLGVLVPFVK  360
HRGNSGSFDG LSNYEVQRYY DEHKEKIFTF GDHSNSSDVR RACGIGISEG NINSSGKIHG  420
EGDSCGVQGR PGNTSEPLFA SLYVPRNDGL VKIDGNLIIN SVLASERAMA SRKNVSETKK  480
EAELTVPSEL SSALAVPEIR GNGVMLPDLY KNREEQYSKA LSASSSEGKR LHQWFHGGSS  540
GALMDYNMCT EVFQFDIAPG AIVPSSVSNV SQEHLKNVTH DKKMNRRFLQ QLPVSLIKSE  600
LNTSGTQSSR DVQNSSLHGN NNKPKSSSMV VSVLLDPREV VDPDTDLVMA PKSLTRIFVV  660
VLLDSVKYVT YSCVLPLSGL NLVTT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00345DAPTransfer from AT3G10800Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006407504.10.0hypothetical protein EUTSA_v10020207mg
SwissprotQ9SG860.0BZP28_ARATH; bZIP transcription factor 28
TrEMBLE4MX700.0E4MX70_EUTHA; mRNA, clone: RTFL01-21-B04
TrEMBLV4M2980.0V4M298_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.3__1116__AT3G10800.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM143971822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10800.10.0bZIP family protein